Products IVD Antigen Viral Protein
Product Introduction
Species
SARS-CoV-2Accession
P0DTC2Amino Acid Sequence
Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)
RVQPTESIVRFPNITNLCPFHEVFNATTFASVYAWNRKRISNCVADYSVIYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKPSGNYKYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGSNCYSPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHHExpression System
HEK293Molecular Weight
Theoretical: 26.3kDa Actual: 33kDaPurity
>95% by SDS-PAGE
Endotoxin
<1EU/μgConjugation
UnconjugatedTag
His TagPhysical Appearance
Lyophilized PowderStorage Buffer
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.Reconstitution
Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.Stability & Storage
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
- 1 week, 2 to 8 °C under sterile conditions after reconstitution.
- Please avoid repeated freeze-thaw cycles.
Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.
Bioactivity
-
Immobilized SARS-CoV-2 (XBB/Omicron) RBD, His tag at 4 μg/mL (50 μL/well) can bind Human ACE2, hFc tag (S0A0071) with EC50 of 37.41-41.32 ng/ml.
-
SDS-PAGE
-
2μg (R: reducing conditions)
-