SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag

Product Introduction

• Species

  SARS-CoV-2

• Accession

  P0DTC2

• Amino Acid Sequence

  Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)
  RVQPTESIVRFPNITNLCPFDEVFNATTFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSTVGGNYNYRYRLFRKSKLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

• Expression System

  HEK293

• Molecular Weight

  Theoretical: 26.3kDa Actual: 33kDa

• Purity

  ＞95% by SDS-PAGE

• Endotoxin

  <1EU/μg

• Conjugation

  Unconjugated

• Tag

  His Tag

• Physical Appearance

  Lyophilized Powder

• Storage Buffer

  Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

• Reconstitution

  Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

• Stability & Storage

  12 months from date of receipt, -20 ℃ to -70 °C as supplied.

  1 month, 2 to 8 °C under sterile conditions after reconstitution.  

  Please avoid repeated freeze-thaw cycles. 

• dilution

• Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

• Bioactivity

  • 

    Immobilized SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag at 4 μg/mL (50 μL/well) can bind Human ACE2/ACEH Protein with EC50 of 14.63-18.37 ng/mL.
    

• SDS-PAGE

  • 

    2μg (R: reducing conditions)