Products IVD Antigen Viral Protein
Product Introduction
Species
SARS-CoV-2Accession
P0DTC2Amino Acid Sequence
RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH
Expression System
HEK293Molecular Weight
35 kDaPurity
>95%Endotoxin
<0.1EU/μgConjugation
UnconjugatedPhysical Appearance
Lyophilized PowderReconstitution
Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.Stability & Storage
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.
Bioactivity
-
Immobilized SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His Tag at 4 μg/mL (50 μL/well) can bind Human ACE2, hFc tag (S0A0071) with EC50 of 20.33-31.67 ng/ml.
-
SDS-PAGE
-
2μg(R: reducing conditions)
-