Monkeypox virus L1R, His Tag

Product Introduction

• Species

  MPXV

• Accession

  Q8V4Z7

• Amino Acid Sequence

  MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH

• Expression System

  E.coli

• Molecular Weight

  19.4 kDa

• Purity

  ＞95% by SDS-PAGE

• Endotoxin

  <1EU/μg

• Conjugation

  Unconjugated

• Tag

  His Tag

• Physical Appearance

  Lyophilized Powder

• Reconstitution

  Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.

• Stability & Storage

  ·12 months from date of receipt, -20 to -70 °C as supplied.

  ·1 month, 2 to 8 °C under sterile conditions after reconstitution.

  ·Please avoid repeated freeze-thaw cycles.

• dilution

• L1R is highly homologous to vaccinia virus protein J1R. Vaccinia virus contains a conserved J1R open reading frame that encodes a late protein of 17.8 kDa. The 18-kDa J1R protein is associated mainly with the membrane fraction of intracellular mature virus particles.

• SDS-PAGE

  • 
    3μg (R: reducing conditions)