Monkeypox virus A29L, His Tag

Product Introduction

• Species

  MPXV

• Accession

  Q9YN60

• Amino Acid Sequence

  MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH

• Expression System

  E.coli

• Molecular Weight

  14.2 kDa

• Purity

  ＞95% by SDS-PAGE

• Endotoxin

  <1EU/μg

• Conjugation

  Unconjugated

• Tag

  His Tag

• Physical Appearance

  Lyophilized Powder

• Reconstitution

  Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

• Stability & Storage

  Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

• dilution

• A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

• SDS-PAGE

  •